PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010527541.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 326aa    MW: 36385.4 Da    PI: 8.0127
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010527541.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.6e-32224279156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a+++LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  XP_010527541.1 224 KQRRCWSPELHRRFLNALQHLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 279
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-28221282IPR009057Homeodomain-like
PROSITE profilePS5129414.256221281IPR017930Myb domain
SuperFamilySSF466896.81E-18222282IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-28224279IPR006447Myb domain, plants
PfamPF002492.8E-7226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MLKNVDMDYA QKMQRCHEYV EALEEERKKI QVFQRELPLC LELVTQAIEA CRREIISGTP  60
SDYVQGQSDC SEQTTSDCGG PVFEEFIPIK RSSSCDEDGE HESRESENDG DEKISTNSGN  120
NTDKKKSDWL RSVQLWNQSP DPQPKEDQAA KMKTVVEVKR NGGAFQPFQK EKLVPKSNQQ  180
PVKATTSAPA PASSQAVTGG GKSELEEAQP QQKQTQTQTQ AQRKQRRCWS PELHRRFLNA  240
LQHLGGSHVA TPKQIRELMK VDGLTNDEVK SHLQKYRLHT RRPATPAQPQ RTPPSPMRSG  300
DGNSGRCNSP ATSSSTHTTT TSSPVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010527541.10.0PREDICTED: uncharacterized protein LOC104804876
TrEMBLQ9FPE81e-122Q9FPE8_ARATH; At1g25550/F2J7_21
STRINGAT1G25550.11e-121(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-107G2-like family protein